PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009138351.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 897aa    MW: 100089 Da    PI: 7.2017
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009138351.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK918.9e-29601651252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ek+i le+l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  XP_009138351.1 601 EKTIGLEVLRQYFAGSLKDAAKNIGVCPTTLKRICRQHGITRWPSRKIKKV 651
                     799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.041590671IPR003035RWP-RK domain
PfamPF020421.8E-24604651IPR003035RWP-RK domain
SuperFamilySSF542777.85E-24787881No hitNo description
Gene3DG3DSA:3.10.20.2403.2E-23792878No hitNo description
SMARTSM006662.8E-28794879IPR000270PB1 domain
PROSITE profilePS5174528.839794879IPR000270PB1 domain
CDDcd064075.52E-40796878No hitNo description
PfamPF005644.0E-19796878IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 897 aa     Download sequence    Send to blast
MEGGSGGGHG GFLPNSSFGA FSETATNMDF MDELFFDGCW LETTDGKSLK QTTPTNMNDN  60
NNSFLYETER KFPQITPGSL KIEDLTDQPT DQVPSDHSAA MSSTQAEKFL LEETERGKRW  120
WIAPRTRQGP SSSVKDRLVQ AIKGLNEAVQ DKDSLIQIWV PIQQEGKNFL TTLEQPHSFN  180
PKHLSLKRYR DASVAYNFLA DEDSKESVGL PGRVFLGKLP EWTPDVRFFR SEEYPRIKEA  240
QKCDVRGSLA LPVFERGSGI CLGVVEIVRT TQKMNYKPEL ENICKALEAV NLRSSENLKS  300
PRSEFLQVYN QFYHAALPEV SNFLASVCRS YDLPLALTWA PCARQEGRGG SRHSDENFSE  360
CVSTVDSACF VLDQQSYHFQ VACSEHHLLQ GEGIVGKAFR RTKLFFVPEV TTFSKTNYSL  420
AHHAKISGLH AALAVPLKNK FNGSVEFVLE FFFPKLCLDT EAQQDMLKSL SVTLQNDFRS  480
LNLVIDKELE LEVVFPVRLE LLFSEKPLPL EPFPLEEISP EDSSWISHMI KANEKGKGVS  540
LSWEYQKEEP KEEFMLTSGW DNNNQIGLGH GHSSFDSASF GVGQSLLGSR RQGEKRRTKT  600
EKTIGLEVLR QYFAGSLKDA AKNIGVCPTT LKRICRQHGI TRWPSRKIKK VGHSLKKLQL  660
VIDSVQGVQG SIQLDSFYTS FPELSSQNVS GTGTGTYFKN AQTENGVSAQ GIASKSPPSS  720
SCSHSSGSST CCSTEANNTA NTLTTLMAEN AGEILKRARS EVKLHTMEET KPISRTRSHK  780
TFSQHPLSLK AGGASKVKAT FGEAKVRFTL LPTWGFRELR HEIARRFNID NNNIATFDLK  840
YLDDDKEWVL LTCEADLEEC IDIYRSSQSR TIKISVHEAS QLKLRGSFGS TGTGPSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1896560.0AC189656.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS015K01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009138351.10.0PREDICTED: protein NLP2-like
RefseqXP_009138352.10.0PREDICTED: protein NLP2-like
RefseqXP_009138353.10.0PREDICTED: protein NLP2-like
RefseqXP_009138354.10.0PREDICTED: protein NLP2-like
SwissprotQ7X9B90.0NLP2_ARATH; Protein NLP2
TrEMBLA0A078HS380.0A0A078HS38_BRANA; BnaA03g53210D protein
STRINGBra017705.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19982777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein